DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Prtn3

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:264 Identity:88/264 - (33%)
Similarity:119/264 - (45%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTT--SNSHFCAGSLLDEVTIVTAAHC 72
            |||....|:..       .:|:.|:||.....||:.|||.:  ..||||.|:|:....::|||||
Mouse    17 LALVVGGAVQA-------SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHC 74

  Fly    73 L---TYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAV 134
            |   ::.....|.|||.....|..| :|||.:| |...||......||:.|:        .||..
Mouse    75 LQDISWQLVTVVLGAHDLLSSEPEQ-QKFTISQ-VFQNNYNPEENLNDVLLL--------QLNRT 129

  Fly   135 ARDGSNPVSAVSLPSKTFQGTSDG---YLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSN 195
            |..|.. |:..|||.:. |..|.|   ...|||| ......|..||:|:..:|.: .|:      
Mouse   130 ASLGKE-VAVASLPQQD-QTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTF-LCR------ 185

  Fly   196 NSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSF 260
                |.||||..|.:|.|.|.|||||||:....     |.|:.|:....|.|..:|..:..||.:
Mouse   186 ----EHNVCTLVPRRAAGICFGDSGGPLICNGI-----LHGVDSFVIRECASLQFPDFFARVSMY 241

  Fly   261 LPWI 264
            :.||
Mouse   242 VDWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 82/243 (34%)
Tryp_SPc 30..267 CDD:238113 84/244 (34%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 82/243 (34%)
Tryp_SPc 30..248 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.