DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1b4

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:281 Identity:79/281 - (28%)
Similarity:119/281 - (42%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVT 68
            |.::| ||| |:..|....|       :......:...|:.|::. ..|.:.|.|.|||...::|
Mouse     3 FLILF-LAL-SLGGIDAAPP-------VQSQVDCENSQPWHVAVY-RFNKYQCGGVLLDRNWVLT 57

  Fly    69 AAHCLTYN-QGQAVAGAHS-RTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKE-----E 126
            ||||  || :.|...|.:: ..|:.:.|.|..:.|  :.|.         |..:.||.|     |
Mouse    58 AAHC--YNDKYQVWLGKNNFLEDEPSDQHRLVSKA--IPHP---------DFNMSLLNEHTPQPE 109

  Fly   127 DAFDLNAVARDGSNP------VSAVSLPSKTFQGTSDGYLYGWGRDN--SGLLPLNLQKLDAIIV 183
            |.:..:.:....|.|      |..::||::..:..|.....|||...  ....|.:||.::..::
Mouse   110 DDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLL 174

  Fly   184 DYNECKAALPSNNSLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPC 245
            ...:|..|  ....:.:..:|.   |:.||   :|..||||||:....     |.||.|||..||
Mouse   175 PNEDCDKA--HEMKVTDAMLCA---GEMDGGSYTCEHDSGGPLICDGI-----LQGITSWGPEPC 229

  Fly   246 LSTTYPSVYTSVSSFLPWIDE 266
            ...|.|||||.:..|..||.|
Mouse   230 GEPTEPSVYTKLIKFSSWIRE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/252 (27%)
Tryp_SPc 30..267 CDD:238113 71/255 (28%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 73/269 (27%)
Activation peptide homolog 18..24 1/12 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.