DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CTRB1

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:279 Identity:98/279 - (35%)
Similarity:134/279 - (48%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVT 68
            |:::.|.....|.||.....|.  .||:||.:|..|..|:.||||..:..|||.|||:.|..:||
Human    10 FSLVGAAFGCGVPAIHPVLSGL--SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVT 72

  Fly    69 AAHCLTYNQGQAVAGAHSR-TDQENVQIRK----FTNAQY-VIHENYGGGVGPNDIGLILLKEED 127
            ||||........|||...: :|:||:|:.|    |.|.:: ::..|       |||.|:.|....
Human    73 AAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVN-------NDITLLKLATPA 130

  Fly   128 AFDLNAVARDGSNPVSAVSLPSK-------TFQGTSDGYLYGWGRD--NSGLLPLNLQKLDAIIV 183
            .|         |..||||.|||.       |...|:     |||:.  |:...|..||:....::
Human   131 RF---------SQTVSAVCLPSADDDFPAGTLCATT-----GWGKTKYNANKTPDKLQQAALPLL 181

  Fly   184 DYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGA-ELIGIVSWGYTPCLS 247
            ...|||.:.  ...:.:..:|....|.:  ||.||||||||.|..  || .|:||||||...| |
Human   182 SNAECKKSW--GRRITDVMICAGASGVS--SCMGDSGGPLVCQKD--GAWTLVGIVSWGSDTC-S 239

  Fly   248 TTYPSVYTSVSSFLPWIDE 266
            |:.|.||..|:..:||:.:
Human   240 TSSPGVYARVTKLIPWVQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 91/250 (36%)
Tryp_SPc 30..267 CDD:238113 91/253 (36%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 91/250 (36%)
Tryp_SPc 34..259 CDD:238113 91/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.