DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1b9

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:283 Identity:78/283 - (27%)
Similarity:126/283 - (44%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QFAVIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIV 67
            :|.::| ||| |:..|....|  ...||:.|::..|...|:.|::. ..|.:.|.|.|||...::
Mouse     2 RFLILF-LAL-SLGGIDAAPP--VHSRIVGGFKCEKNSQPWHVAVY-RYNEYICGGVLLDANWVL 61

  Fly    68 TAAHCLTYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDI---------GLILL 123
            |||||. |.:.:...|.::..::|.....:..:..: :|..|...:..|.|         .|:||
Mouse    62 TAAHCY-YEENKVSLGKNNLYEEEPSAQHRLVSKSF-LHPGYNRSLHRNHIRHPEYDYSNDLMLL 124

  Fly   124 KEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLLPL------NLQKLDAII 182
            :.....|:..|       |..::||::..:..|.....|||    ...|.      :||.::..:
Mouse   125 RLSKPADITDV-------VKPIALPTEEPKLGSTCLASGWG----STTPFKFQNAKDLQCVNLKL 178

  Fly   183 VDYNEC-KAALPSNNSLAETNVCTHTPGKADG---SCNGDSGGPLVSQSSSRGAELIGIVSWGYT 243
            :...:| ||.:   ..:.:..:|.   |:.||   :|.|||||||:..     ..|.||.|||:|
Mouse   179 LPNEDCGKAHI---EKVTDVMLCA---GETDGGKDTCKGDSGGPLICD-----GVLQGITSWGFT 232

  Fly   244 PCLSTTYPSVYTSVSSFLPWIDE 266
            ||.....|.|||.:..|..||.:
Mouse   233 PCGEPKKPGVYTKLIKFTSWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/253 (27%)
Tryp_SPc 30..267 CDD:238113 69/256 (27%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 68/253 (27%)
Tryp_SPc 25..256 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.