DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk1b22

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:274 Identity:70/274 - (25%)
Similarity:116/274 - (42%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QFAVIF-ALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTI 66
            :|.::| .|:|..:.|....|     .||:.|::..|...|:.|::... :.:.|.|.|||...:
Mouse     2 RFLILFLTLSLGGIDAAPPVQ-----SRILGGFKCEKNSQPWQVAVYYL-DEYLCGGVLLDRNWV 60

  Fly    67 VTAAHCL--TYN--QGQAVAGAHSRTDQENVQIRKFTNAQY---VIHENYGGGVGPNDIGLI-LL 123
            :|||||.  .||  .|:........:.|..:..:.|.:..:   ::.....|....||:.|: |.
Mouse    61 LTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLS 125

  Fly   124 KEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLLPLNLQKLDAIIVDYNEC 188
            |..|..|:          |..:.||:...:..|.....|||..|. |:..|...|..:.:..:..
Mouse   126 KPADITDV----------VKPIDLPTTEPKLGSTCLASGWGSINQ-LIYQNPNDLQCVSIKLHPN 179

  Fly   189 KAALPSN-NSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPS 252
            :..:.:: ..:.:..:|.........:|.|||||||:..     ..|.||.|||.|||.....|:
Mouse   180 EVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICD-----GVLQGITSWGSTPCGEPNAPA 239

  Fly   253 VYTSVSSFLPWIDE 266
            :||.:..|..||.:
Mouse   240 IYTKLIKFTSWIKD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 62/243 (26%)
Tryp_SPc 30..267 CDD:238113 63/246 (26%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 62/243 (26%)
Tryp_SPc 25..254 CDD:238113 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.