DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Ctrl

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:124/260 - (47%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC-LTYN 76
            |...|:|..|      ||:||..|..|..|:.||||..:..|||.|||:....:|||||| :|..
  Rat    23 AITPALSYNQ------RIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLIAPNWVVTAAHCKVTPG 81

  Fly    77 QGQAVAGAHSR-TDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAF--DLNAVARDG 138
            :...:.|.:.| ::.|.:|:...:.|  :.|.::......||:.|:.|.....:  .::.|....
  Rat    82 RHFVILGEYDRSSNAEPIQVLSISKA--ITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLAS 144

  Fly   139 SNPVSAVSLPSKTFQGTSDGYLYGWGRDN--SGLLPLNLQKLDAIIVDYNECKAALPSNNSLAET 201
            ||......|...|         .||||.:  ..:.|..||::...:|..|:|:....|.  :.::
  Rat   145 SNEALPAGLTCVT---------TGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSR--ITDS 198

  Fly   202 NVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            .:|  ..|....||.||||||||.|..:... ||||||||...| :...|::||.||.|..||::
  Rat   199 MIC--AGGAGASSCQGDSGGPLVCQKGNTWV-LIGIVSWGTENC-NVQAPAMYTRVSKFNTWINQ 259

  Fly   267  266
              Rat   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/240 (33%)
Tryp_SPc 30..267 CDD:238113 79/243 (33%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 78/240 (33%)
Tryp_SPc 34..260 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.