DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Acr

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_038483.1 Gene:Acr / 11434 MGIID:87884 Length:436 Species:Mus musculus


Alignment Length:261 Identity:80/261 - (30%)
Similarity:115/261 - (44%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQ--TTSNS---HFCAGSLLDEVTIVTAAHCLTYNQ----GQAVAGA 84
            ||::|..|..|..|::||||  |:.||   |.|.||||:...::|||||....:    .:.|.||
Mouse    42 RIVSGQSAQLGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYDWRLVFGA 106

  Fly    85 HSRTDQENVQIRKFTNAQY----VIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAV 145
            .......|..:::....:|    ||||.|......|||.|:.:......         .|.:...
Mouse   107 QEIEYGRNKPVKEPQQERYVQKIVIHEKYNVVTEGNDIALLKITPPVTC---------GNFIGPC 162

  Fly   146 SLP---SKTFQGTSDGYLYGWG-------RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAE 200
            .||   :...|.....|:.|||       |.:..|:...:.     ::|.:.|.:....|..:..
Mouse   163 CLPHFKAGPPQIPHTCYVTGWGYIKEKAPRPSPVLMEARVD-----LIDLDLCNSTQWYNGRVTS 222

  Fly   201 TNVCTHTP-GKADGSCNGDSGGPLVSQSS-SRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPW 263
            ||||...| ||.| :|.|||||||:.:.: .....::||.||| ..|.....|.|||:...:|.|
Mouse   223 TNVCAGYPEGKID-TCQGDSGGPLMCRDNVDSPFVVVGITSWG-VGCARAKRPGVYTATWDYLDW 285

  Fly   264 I 264
            |
Mouse   286 I 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 78/259 (30%)
Tryp_SPc 30..267 CDD:238113 79/260 (30%)
AcrNP_038483.1 Tryp_SPc 42..286 CDD:214473 78/259 (30%)
Tryp_SPc 43..289 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.