DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and St14

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:254 Identity:70/254 - (27%)
Similarity:100/254 - (39%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL---------TYNQGQAVA 82
            :.|::.|..|.:||.|:.|||......|.|..||:....:|:||||.         .:....|..
  Rat   612 QARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAFL 676

  Fly    83 GA--HSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAV 145
            |.  .|:.....||..|.  .:.:.|.::.......||.|:.|::...:         |..|..:
  Rat   677 GLLDQSKRSASGVQEHKL--KRIITHPSFNDFTFDYDIALLELEKPAEY---------STVVRPI 730

  Fly   146 SLPSKT--FQGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHT 207
            .||..|  |......::.|||. ...|...|.|||.:..:::...|:..||  ..:....:|...
  Rat   731 CLPDNTHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEELLP--QQITPRMMCVGF 793

  Fly   208 PGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            ......||.|||||||.|..........|:|||| ..|.....|.|||.:.....||.|
  Rat   794 LSGGVDSCQGDSGGPLSSVEKDGRIFQAGVVSWG-EGCAQRNKPGVYTRIPEVRDWIKE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 67/248 (27%)
Tryp_SPc 30..267 CDD:238113 69/251 (27%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.