DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and CTRC

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:189 Identity:52/189 - (27%)
Similarity:81/189 - (42%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFALALASVSAISVPQPGFP---EGRIINGYEAAKGEAPYIVSLQTTSNS---HFCAGSLLDEVT 65
            :.|..||..|:..|  |.||   ..|::.|.:|.....|:.:|||...|.   |.|.|:|:....
Human     6 VLAALLACASSCGV--PSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNF 68

  Fly    66 IVTAAHCLTYNQGQAVAGAHSRTDQENVQIRKFTNAQYV-IHENYGGGVGPNDIGLILLKEEDAF 129
            ::|||||::..:...||...:..:.|:.:...|.....: :|:.:...:..|||.||.|.|....
Human    69 VLTAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVEL 133

  Fly   130 DLNAVARDGSNPVSAVSLPSKTFQGTSD--GYLYGWGRDNSGL-----LPLNLQKLDAI 181
                     |:.:....||.|......|  .|:.||||...||     ||:..:.|..:
Human   134 ---------SDTIQVACLPEKDSLLPKDYPCYVTGWGRLWRGLRWPTELPVGERFLGGV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 44/164 (27%)
Tryp_SPc 30..267 CDD:238113 43/163 (26%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 38/142 (27%)
Tryp_SPc 30..>173 CDD:238113 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24250
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.