DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC108647852

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:250 Identity:76/250 - (30%)
Similarity:107/250 - (42%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHF---CAGSLLDEVTIVTAAHCLT----YNQ-GQAVAGAH 85
            |:|.|.....|..|::.|:|......:   |.|.||....:|||||||:    |.. .:.|.||.
 Frog    43 RVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNRWVVTAAHCLSDLKRYRHLARIVLGAR 107

  Fly    86 SRTD-QENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPS 149
            ..|. ....|||  |..|::.||::......|||.||.|.....|         |:.:....||.
 Frog   108 DLTQLGPETQIR--TIKQWIQHEDFDHKTHKNDIALIRLNYPVKF---------SDYIQPACLPP 161

  Fly   150 KT--FQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGK 210
            |:  .....|.::.|||  .:....:...||:....::|...|.::...|..:.:.|:|......
 Frog   162 KSSNVYKMDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCNSSDWYNGGIHDDNLCAGYEQG 226

  Fly   211 ADGSCNGDSGGPLVSQSSSRGA-ELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            ....|.|||||||:.:....|. .::||||||.. |.......|||||..|..||
 Frog   227 GPDVCMGDSGGPLMCKRKKAGIYYVVGIVSWGGL-CGQPHSNGVYTSVQDFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/248 (30%)
Tryp_SPc 30..267 CDD:238113 74/248 (30%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.