DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC103908930

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:265 Identity:76/265 - (28%)
Similarity:109/265 - (41%) Gaps:38/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIFALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAA 70
            |:|||.:.:|:.       .|..:||.|||......|:.:.: |.....:|..||::|...|:||
Zfish     4 VVFALLVVNVAC-------SPVDKIIGGYECPPNSQPWQIYI-TNDGQRWCGASLINESWAVSAA 60

  Fly    71 HC------LTYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAF 129
            ||      ||...|:.......:|:|.....:.|.:.::.....      .|||.||.||:...|
Zfish    61 HCNIGANLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFKFPSE------DNDIMLIKLKDPAVF 119

  Fly   130 DLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLLPLNLQKLDAIIVDYNECKAALPS 194
                     :..|..:.|.:..........:.|||....| ||..||.||..:....||:...  
Zfish   120 ---------NQYVQPIPLATSCSSEGEQCLVSGWGYTEVG-LPSVLQCLDLAVQSRQECERVY-- 172

  Fly   195 NNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSS 259
            .:...:..:|........|.|:||||||||.     ..||.|:|||| ..|....||:||..|..
Zfish   173 KDKFTQNMLCAGFMEGGKGVCHGDSGGPLVC-----NGELRGVVSWG-AGCAEPGYPAVYVEVCR 231

  Fly   260 FLPWI 264
            :..||
Zfish   232 YSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 68/240 (28%)
Tryp_SPc 30..267 CDD:238113 70/241 (29%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.