DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and Klk5

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:244 Identity:72/244 - (29%)
Similarity:108/244 - (44%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAV----AGAHSRTD 89
            ||:||.:..|...|:..:|....|..:|...|::...::|||||     .:.|    .|.||.:.
  Rat    67 RIVNGSDCPKDTQPWQGALLLGPNKLYCGAVLINPQWLLTAAHC-----RKPVFRIRLGHHSMSP 126

  Fly    90 QENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQG 154
            ......:.|...:.:.|..|......||  |:|:|      :|...| .|:.|..|.:.|...:.
  Rat   127 VYESGQQMFQGIKSIPHPGYSHPGHSND--LMLIK------MNRKIR-ASHSVKPVEITSDCPKE 182

  Fly   155 TSDGYLYGWGRDNS--GLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSCNG 217
            .:...:.|||..:|  ...|..||.||..::....||.:.|  ..:.:|..|.......| ||.|
  Rat   183 GTRCMVSGWGTTSSSHNNFPKVLQCLDITVLSEERCKNSYP--GQIDKTMFCAGDEAGRD-SCQG 244

  Fly   218 DSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDE 266
            |||||::.     ..:|.|:||||..||.....|.|||::..|:|||.:
  Rat   245 DSGGPVIC-----NGKLQGLVSWGDFPCAQPNRPGVYTNLCEFVPWIKD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 70/240 (29%)
Tryp_SPc 30..267 CDD:238113 71/243 (29%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.