DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC101732100

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031749505.1 Gene:LOC101732100 / 101732100 -ID:- Length:327 Species:Xenopus tropicalis


Alignment Length:280 Identity:86/280 - (30%)
Similarity:128/280 - (45%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFALALASVS----------AISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLL 61
            :|||.|.::.          |||        .||:.|.:|.||:.|: .:|......:.|.|:|:
 Frog    12 LFALGLYTICEAEKACGKSVAIS--------DRIVGGQDAKKGKYPW-QALLWCPGVYRCGGTLV 67

  Fly    62 DEVTIVTAAHCLTYNQGQAVA---GAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILL 123
            ....:|:|||||:.:....:|   ||:..:..||.::.......| ||.||......|||||..|
 Frog    68 SSKWVVSAAHCLSRSNASCLAVILGANKLSGNENEEMAVSVKNIY-IHPNYNDTDITNDIGLAEL 131

  Fly   124 KEEDAFDLNAVARDGSNPVSAVSLP--SKTFQGTSDGYLYGWG--RDNSGLLPLNLQKLDAIIVD 184
            .:..:|         ::.|..|.||  |..|......::.|||  ..|:.|.|..||::...|:.
 Frog   132 TQAVSF---------TSYVIPVCLPTASTIFNPGQSCWVTGWGVTEFNTSLSPNTLQEVQMRILS 187

  Fly   185 YNECKAALPSNNS---LAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAE--LIGIVSWGYTP 244
            ..:|::....|.:   :.:..:|.........||.||||||||   .|.|..  |:|:||:| ..
 Frog   188 AEQCRSYYDPNITGVYITDQMICARDILGGKDSCQGDSGGPLV---CSYGGNFYLVGVVSFG-IG 248

  Fly   245 CLSTTYPSVYTSVSSFLPWI 264
            |..|.||.|||.|.::..||
 Frog   249 CGDTAYPGVYTYVPAYRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 77/246 (31%)
Tryp_SPc 30..267 CDD:238113 78/247 (32%)
LOC101732100XP_031749505.1 Tryp_SPc 37..268 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.