DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:271 Identity:75/271 - (27%)
Similarity:116/271 - (42%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC--L 73
            :|:::.....|.|.. ..||:.|..:.:|..|::|||:...| |.|.|||::...::|||||  |
Zfish    53 SLSNLQVCGRPNPQL-NPRIVGGLNSTEGAWPWMVSLRYYGN-HICGGSLINNEWVLTAAHCVNL 115

  Fly    74 TYNQGQAVAGAHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDG 138
            |.:......|...|...:..:|.: |.:..:.|.:|......|||.|:.|.....:.      |.
Zfish   116 TRSNMLVYLGKWRRYAADVNEITR-TVSNIIPHPSYNSTTYDNDIALLQLSSTVHYS------DY 173

  Fly   139 SNPVSAVSLPSKTFQGTSDGYLYGWGR----DNSGL-------LPLN----LQKLDAIIVDYNEC 188
            ..||......|....||. .:..||||    ...|:       :||.    ||::...:....:|
Zfish   174 IKPVCLADEQSNFPPGTR-SWATGWGRIGVSGKGGIRGRTTVSVPLPPPGILQEVKLKVYSNADC 237

  Fly   189 KAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSV 253
            .:.  .:..:....:|..|......:.:|||||||||:..|...: .|:||.|| .|.....|.|
Zfish   238 NSI--CHGRINPNMICAGTRSGGKATFSGDSGGPLVSKQCSVWVQ-AGVVSHGY-GCAQPNLPEV 298

  Fly   254 YTSVSSFLPWI 264
            :..||.:..||
Zfish   299 FIRVSEYKQWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 70/251 (28%)
Tryp_SPc 30..267 CDD:238113 71/252 (28%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.