DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC100535114

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009296342.3 Gene:LOC100535114 / 100535114 -ID:- Length:329 Species:Danio rerio


Alignment Length:295 Identity:81/295 - (27%)
Similarity:127/295 - (43%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KQFAVIFALALASVSAISV------PQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSL 60
            ::..||..|.:....::|.      |.|.| ..||:.|..|.:|..|::|||: .|..|||.|||
Zfish     3 RKTCVILLLVMCVRDSLSQPDVCGRPNPNF-NPRIVGGVNATEGSWPWMVSLR-KSGVHFCGGSL 65

  Fly    61 LDEVTIVTAAHCLTYNQGQAVAGAH--------SRTDQENVQIRKFTNAQYVIHENYGGGVGPND 117
            ::...::|||||::   |:..:..|        ..|||..:   ..|....:.|.:|......||
Zfish    66 INNQWVLTAAHCIS---GKTTSSMHVYLGKWRRYETDQNEI---TRTVIDIIPHPSYNNRTSDND 124

  Fly   118 IGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGR----DNSGL-------L 171
            |.|:.|.....:.:..      .|:......|...:||. .::.||||    ...|:       :
Zfish   125 IALLQLSATVQYTVYI------KPICLADQNSNFPRGTR-SWVTGWGRIGVSGTGGISGRTTVSV 182

  Fly   172 PLN----LQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGA 232
            ||.    ||:::..:  |:..|.:......:....:|..|.....|:..|||||||:|:..|...
Zfish   183 PLPAPGILQEVELQV--YSNEKCSKRCQGPITPNMICAGTRSGGKGTFYGDSGGPLMSKQCSVWV 245

  Fly   233 ELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDEN 267
            : .|:||.|| .|.....|.|:..||.:..||.:|
Zfish   246 Q-AGVVSHGY-GCAQPKIPGVFIRVSEYKQWITDN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 71/257 (28%)
Tryp_SPc 30..267 CDD:238113 72/259 (28%)
LOC100535114XP_009296342.3 Tryp_SPc 36..278 CDD:238113 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.