DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC100495222

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031749236.1 Gene:LOC100495222 / 100495222 -ID:- Length:755 Species:Xenopus tropicalis


Alignment Length:299 Identity:83/299 - (27%)
Similarity:133/299 - (44%) Gaps:56/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFAVIFALALASVSAISVPQP----------GFP--EGRIINGYEAAKGEAPYIVSLQTTSNS 53
            |:| .:::.:.|..:.:.:..||          |.|  ..||:.|.:..:|..|:.:||: .:.|
 Frog     1 MRQ-GLLYVMGLLLLVSPNTSQPSIITAAPPLCGNPVFSSRIVGGTDTRQGAWPWQISLE-FNGS 63

  Fly    54 HFCAGSLLDEVTIVTAAHCLTY---NQGQAV-AGAHSRTDQENVQIRKFTNAQYVIHENYGGGVG 114
            |.|.||::.:..|:|||||:.:   ..|..| .||:....:...:|.....|.|| :..:.|...
 Frog    64 HICGGSIVSDQWILTAAHCIEHPDMPSGYGVRLGAYQLYVKNPHEITIKVTAIYV-NSQFDGPGA 127

  Fly   115 PNDIGLILLKEEDAFDLNAVARDGSNPVS------AVSLP--SKTFQGTSDGYLYGWGRDNSGL- 170
            ..||.|:.|               |:|:.      .:.:|  :.||...:..::.|||...||: 
 Frog   128 SGDIALLKL---------------SSPIKYTEYILPICMPTATATFPPGTQCWVTGWGEIGSGVS 177

  Fly   171 --LPLNLQKLDAIIVDYNECKAALPSNNSLAETNV-------CT-HTPGKADGSCNGDSGGPLVS 225
              .|..|||:...::..:.|......|:.::.:.|       |. :..|:.|| |.||||||||.
 Frog   178 LQYPATLQKVMVPLIGRDVCDKMYHINSIISNSEVLIQNDQICAGYQVGQKDG-CQGDSGGPLVC 241

  Fly   226 QSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            |......: .|||||| ..|.:...|.|||.|.::..||
 Frog   242 QIQGIWYQ-AGIVSWG-EGCAAKNRPGVYTFVPAYESWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 74/257 (29%)
Tryp_SPc 30..267 CDD:238113 75/258 (29%)
LOC100495222XP_031749236.1 Tryp_SPc 41..279 CDD:238113 75/258 (29%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.