DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and tmprss11f

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:265 Identity:84/265 - (31%)
Similarity:120/265 - (45%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FALALASVSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHC 72
            :....|..:|..:..|.. ..||:.|..|..|..|:..||:.. .||.|..|||::..:|.||||
 Frog   176 YTTTAADFTACGIGGPSV-SNRIVGGTNAGLGSWPWQASLRLL-GSHTCGASLLNDTWLVAAAHC 238

  Fly    73 LTYNQGQAVAGAHSRT---DQENVQI-RKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNA 133
            ...|     |.|:|.|   ...||.. .:|...:.:|:|.|......|||.  |||.....:..:
 Frog   239 FDMN-----ADANSWTVVLGTINVYSGSEFKIEKIIIYEGYTSHNHRNDIA--LLKLFTPLNFTS 296

  Fly   134 VARDGSNPVSAVSLP--SKTFQGTSDGYLYGWGR-DNSGLLPLNLQKLDAIIVDYNECKAALPSN 195
            :.|       .|.||  |..|...|..|:.|||. .:.|.....||:.:..|::.:.|.::....
 Frog   297 IIR-------PVCLPEASDIFPDGSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYG 354

  Fly   196 NSLAETNVCT-HTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSS 259
            ..:..:.:|. :..|:.| ||.||||||||:..|.|.. ||||||:|| .|.....|.||:.::.
 Frog   355 GLIYPSMICAGYATGQID-SCQGDSGGPLVTLKSGRWV-LIGIVSFGY-GCALPNKPGVYSRITY 416

  Fly   260 FLPWI 264
            ...||
 Frog   417 LRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 79/242 (33%)
Tryp_SPc 30..267 CDD:238113 80/243 (33%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 78/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.