DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC100331291

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:257 Identity:78/257 - (30%)
Similarity:114/257 - (44%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSRTDQENV 93
            :|:.|.:|..|..|:.||||.....|.|..||:....:|:||||  :....|:..:.:|:.:..:
Zfish   690 KIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVASRWLVSAAHC--FQDSDAIKYSDARSWRAYM 752

  Fly    94 QIR---KFTNA-------QYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLP 148
            .:|   ..:||       :.|:|..|.......||.|:.|.....|  |.:.:    || .|..|
Zfish   753 GMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSAPVFF--NELVQ----PV-CVPAP 810

  Fly   149 SKTFQGTSDGYLYGWG-RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNVCTHTPGKAD 212
            |..|...:..::.||| ....|.|...||:....|:::|.|....  ::::....:|.   |...
Zfish   811 SHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMY--DDAVTPRMLCA---GNIQ 870

  Fly   213 G---SCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWIDENRKAK 271
            |   :|.||||||||.....|...|.|||||| ..|.....|.|||.|..|..||.:..|.:
Zfish   871 GGVDACQGDSGGPLVCLERGRRWFLAGIVSWG-EGCARQNRPGVYTRVIKFTDWIHQQTKGQ 931

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 75/248 (30%)
Tryp_SPc 30..267 CDD:238113 77/250 (31%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060
Tryp_SPc 691..927 CDD:238113 77/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.