DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and zgc:165423

DIOPT Version :10

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001093620.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:411 Species:Danio rerio


Alignment Length:137 Identity:44/137 - (32%)
Similarity:65/137 - (47%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SNPVSAVSLPS--KTFQGTSDGYLYGWGRDNSGL---LPLNLQKLDAIIVDYNECKAALPSNNSL 198
            ||.:..|.|.:  .||...: .::.|||...||:   .|..||:::..||..|.|.......:|:
Zfish    13 SNYIQPVCLAADGSTFYNDT-MWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSI 76

  Fly   199 AETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPW 263
            ....:|.........||.||||||:|.:|.:...: .|:||:| ..|....||.||..||.:..|
Zfish    77 TNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQ-AGVVSFG-KGCADPNYPGVYARVSQYQNW 139

  Fly   264 IDENRKA 270
            |.:..:|
Zfish   140 ISQYVRA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 41/129 (32%)
zgc:165423NP_001093620.1 Tryp_SPc <2..142 CDD:238113 43/131 (33%)
Tryp_SPc 178..346 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.