DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC100005420

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021332645.1 Gene:LOC100005420 / 100005420 -ID:- Length:798 Species:Danio rerio


Alignment Length:256 Identity:71/256 - (27%)
Similarity:107/256 - (41%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTIVTAAHCL----------TYNQGQAVAG 83
            ||:.|.:|.:||.|:..|||.... |.|.|:|:....:|:||||.          |...|: :..
Zfish   563 RIVGGADAVEGEWPWQASLQIRGR-HICGGALVSAQWVVSAAHCFHDDRYSPSVWTVYLGK-LRL 625

  Fly    84 AHSRTDQENVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSA---- 144
            :.|...:|.|.:     :...:|..|.......|:.|:.|               :.||.|    
Zfish   626 SSSGQSEEAVGV-----SLIHLHHYYDDETHDYDVALLRL---------------ARPVWAGTLA 670

  Fly   145 --VSLPSKTFQGTSD--GYLYGWG--RDNSGLLPLNLQKLDAIIVDYNECKAALPSNNSLAETNV 203
              |.:|..|.|...:  .::.|||  |:...:..: |||:|..:|..:.|..:.  ...::...:
Zfish   671 QPVCVPPVTHQLEPELLCWVTGWGALREGGAVSDV-LQKVDVRLVSEDACVRSY--GYLISPRMI 732

  Fly   204 CTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            |.........:|.||||||||.|..|....|.|:|||| ..|....|..|||.::....||
Zfish   733 CAGYRSGGKDACQGDSGGPLVCQEPSGRWFLAGVVSWG-RGCGRADYYGVYTRITKLSVWI 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 69/254 (27%)
Tryp_SPc 30..267 CDD:238113 70/255 (27%)
LOC100005420XP_021332645.1 SEA 76..169 CDD:307516
LDLa 446..476 CDD:238060
LDLa 481..512 CDD:238060
LDLa 518..553 CDD:238060
Tryp_SPc 564..794 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.