DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11912 and LOC100004427

DIOPT Version :9

Sequence 1:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:251 Identity:71/251 - (28%)
Similarity:108/251 - (43%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIINGYEAAKGEAPYIVSLQTTSNSH-FCAGSLLDEVTIVTAAHCLTYNQGQAVAGAHSRTDQEN 92
            :|:.|..|.:|..|:..|:...|... ||:|||:.|..::|||.|.            .|.:..:
Zfish    35 KIVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCF------------QRINVSD 87

  Fly    93 VQI---RKFTNAQ--YVIHENYGGGVGPNDIGLILLKEEDAFDLNAVARDGSNPVSAVSLPSKTF 152
            |.|   |..||..  |.|...........||.|:.|.....|      .|...||...:..|...
Zfish    88 VVIYLGRLTTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTF------TDYIRPVCLAAAGSVFV 146

  Fly   153 QGTSDGYLYGWGRDNSGLLPLN--LQKLDAIIVDYNECKAALPSNNSLAETN----VC---THTP 208
            .|| :.::.|||..:|..:.|:  |::::|.||:..||      :|....||    :|   .:..
Zfish   147 DGT-ESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIEC------SNINGITNLDNVICAGFVNET 204

  Fly   209 GKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYTSVSSFLPWI 264
            |||  .|..|.|.|||::..|:..: .|:|.  :|.|....:|::|..||.:..||
Zfish   205 GKA--PCWEDFGSPLVTRQGSQWIQ-SGVVV--FTFCGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 69/249 (28%)
Tryp_SPc 30..267 CDD:238113 71/250 (28%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 69/249 (28%)
Tryp_SPc 36..257 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.