DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plc21C and plc-4

DIOPT Version :10

Sequence 1:NP_995605.1 Gene:Plc21C / 33204 FlyBaseID:FBgn0004611 Length:1318 Species:Drosophila melanogaster
Sequence 2:NP_501213.1 Gene:plc-4 / 177525 WormBaseID:WBGene00004039 Length:751 Species:Caenorhabditis elegans


Alignment Length:99 Identity:22/99 - (22%)
Similarity:35/99 - (35%) Gaps:29/99 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GLIGAPNSGTYTGAKHALHGYFEALRNEYPNVHVTMFCPGPTATNFLQEC-FTDTPGAKYNQTVQ 256
            |..|:.|:..|        |.::.      |.|::....|.|..::.... ..|.|.....::||
 Worm    64 GFSGSDNASFY--------GSYDM------NDHLSRMSIGRTNWDYHPMVNVADDPENTVARSVQ 114

  Fly   257 --PTDRRMTSERCGHLYALAIANK-----THLSW 283
              .||....:|.|       |||:     ..:||
 Worm   115 IGDTDEHSEAEEC-------IANEHDPDSPQVSW 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plc21CNP_995605.1 PH_PLC_beta 20..145 CDD:270167
EFh_PI-PLC21 151..305 CDD:320043 22/99 (22%)
EF-hand motif 151..180 CDD:320043
EF-hand motif 187..216 CDD:320043 5/22 (23%)
EF-hand motif 225..255 CDD:320043 5/30 (17%)
EF-hand motif 272..305 CDD:320043 5/17 (29%)
PI-PLCc_beta 317..702 CDD:176533
C2_PLC_like 736..855 CDD:175974
PTZ00121 <981..>1253 CDD:173412
plc-4NP_501213.1 PH-like 29..145 CDD:473070 22/99 (22%)
EFh_PI-PLC 160..>260 CDD:333715
EF-hand motif 160..189 CDD:320029
EF-hand motif 196..226 CDD:320029
PLN02228 221..751 CDD:177873
EF-hand motif 231..260 CDD:320029
PI-PLCc_eukaryota 315..596 CDD:176501
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.