DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K21B and plcg1

DIOPT Version :9

Sequence 1:NP_001259817.1 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_919388.1 Gene:plcg1 / 373867 ZFINID:ZDB-GENE-030421-3 Length:1312 Species:Danio rerio


Alignment Length:233 Identity:55/233 - (23%)
Similarity:98/233 - (42%) Gaps:64/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NEDELR------------MAPWYWGRI-----SREEAKSILH------GKPDGSFLVRDALSMKG 54
            ||||..            ...|:.|::     .|:.|:.:|.      |.||||||||::.:..|
Zfish   524 NEDEEEHREICNGMDQHVTEKWFHGKLGAGRDGRQIAERLLSEYCVETGAPDGSFLVRESETFVG 588

  Fly    55 EYTLTLMKDGCEKLIKICHMDRKYG---FIETD--LFNSVVEMINYYKENSLSMYNKTLDITLSN 114
            :|||:..:.|..:..:| |..::.|   |..||  :|:::..:|.:|::..|..  ...::.|:.
Zfish   589 DYTLSFWRSGRVQHCRI-HSRQEAGSPKFYLTDNLVFDTLFALITHYQQVPLRC--NEFEMKLTE 650

  Fly   115 PIVRAREDEESQPHGDLCLLSNEFIRTC-------QLLQNLEQN---LENKRNSFN----AIREE 165
            |:.:....|           |.|:...|       .:|..:.::   |..||..||    :.|.|
Zfish   651 PVPQTNAHE-----------SKEWYHACLSRSQAENMLMRVPRDGAFLVRKRTEFNSFAISFRAE 704

  Fly   166 --LQEKKLHQS----VFGNTEKIFRNQIKLNESFMKAP 197
              ::..::.|.    |.|.:|  |.:.:.|...:.|.|
Zfish   705 GKIKHCRVQQEGQTVVLGTSE--FDSLVDLISYYEKHP 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K21BNP_001259817.1 SH2_nSH2_p85_like 14..123 CDD:198195 34/136 (25%)
PI3K_P85_iSH2 129..302 CDD:293063 19/89 (21%)
iSH2_PI3K_IA_R 138..303 CDD:304922 17/80 (21%)
SH2_cSH2_p85_like 320..422 CDD:198184
plcg1NP_919388.1 PH_PLC_gamma 29..151 CDD:270168
PH <71..142 CDD:278594
EF-hand_like 242..306 CDD:286375
PI-PLCc_gamma 314..>472 CDD:176534
PH-like 484..>521 CDD:302622
SH2_N-SH2_PLC_gamma_like 540..644 CDD:199829 29/106 (27%)
SH2_C-SH2_PLC_gamma_like 658..760 CDD:198186 20/96 (21%)
SH3_PLCgamma1 786..845 CDD:212903
PHsplit_PLC_gamma <857..928 CDD:270054
PH <865..924 CDD:278594
PLCYc 949..1064 CDD:128454
C2_PLC_like 1082..1206 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.