DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K21B and Socs44A

DIOPT Version :10

Sequence 1:NP_477270.2 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster


Alignment Length:88 Identity:30/88 - (34%)
Similarity:46/88 - (52%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PNE------DELRMAPWYWGRISREEAKSILHGKPDGSFLVRDALSMKGEYTLTLMKDGCEKLIK 70
            ||:      .|:....||||.|||.:::..|..||.|||||||:.:...::||:..........:
  Fly   173 PNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYR 237

  Fly    71 ICHMDRKYGFIETDLFNSVVEMI 93
            :.:.|..:.|.|.. :.|:||||
  Fly   238 LEYRDNFWHFEELK-YESIVEMI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K21BNP_477270.2 SH2_nSH2_p85_like 14..123 CDD:198195 28/86 (33%)
PI3K_P85_iSH2 120..303 CDD:465121
SH2_cSH2_p85_like 320..422 CDD:198184
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 27/73 (37%)
SOCS 293..333 CDD:470605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.