DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K21B and Socs36E

DIOPT Version :9

Sequence 1:NP_001259817.1 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster


Alignment Length:297 Identity:68/297 - (22%)
Similarity:132/297 - (44%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PNEDELRMAPWYWGRISREEAKSILHGKPDGSFLVRDALSMKGEYTLTLMKDGCEKLIKICHMDR 76
            |:.:::..:.:|||::.|.||:.:|.|||:|:||:||:...:..:::|..|.|.....:|.....
  Fly   464 PDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGH 528

  Fly    77 KYGFIETD--LFN--SVVEMINYYKENSLSMYNKTLDITLSNPIVRAREDEESQPHGDLCLLSN- 136
            |:.|...|  :|.  :|..::.:||:.:..|:   .:..|:.|:.| |:....|......::|| 
  Fly   529 KFSFDCHDPCVFTAPTVTGLLEHYKDPACVMF---FEPCLTIPLHR-RQTFSLQQLSRATIVSNT 589

  Fly   137 --EFIRTCQLLQNLEQNLENKRNSFNAIREELQEKKLHQSV----FGNTEKIFRNQIKLNESFMK 195
              :.|...:|...|:..|:...     .:::|:.|.:.|:.    :||   :.|.:.::..::.:
  Fly   590 SYDGINQMELPGRLKSYLKEYH-----YKQKLRVKPIDQNTPMPYYGN---VXREEQQVGFTYYE 646

  Fly   196 APADAPSTEAGGAGD-----GAN--------------------AAASAAANANARRSLQEHKQTL 235
                  ..|:|...|     |.|                    |:..:|.:::...:||||...|
  Fly   647 ------DVESGSEVDEDDDEGVNIRVSYVQHAEVVAQLQQVTTASGPSAPSSSRSSNLQEHLSRL 705

  Fly   236 LNLLDALQAKGQV---LNHYMENKKKEELLLERQINA 269
            .|.:.|  |.|::   ||.|    :|.....||..|:
  Fly   706 PNRMAA--AFGRMSANLNCY----QKTVATPERHSNS 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K21BNP_001259817.1 SH2_nSH2_p85_like 14..123 CDD:198195 31/112 (28%)
PI3K_P85_iSH2 129..302 CDD:293063 35/176 (20%)
iSH2_PI3K_IA_R 138..303 CDD:304922 33/164 (20%)
SH2_cSH2_p85_like 320..422 CDD:198184
Socs36ENP_523593.5 SH2 463..563 CDD:301589 28/101 (28%)
SOCS 575..626 CDD:295349 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10155
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.