DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pi3K21B and Socs16D

DIOPT Version :9

Sequence 1:NP_001259817.1 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:79/176 - (44%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WYWGRISREEAKSILHGKPDGSFLVRDALSMKGEYTLTLMKDGCEKLIKICHMDRKYGFIETDLF 86
            ||||.:|.|.|:.:|..:|||||:|||:......::|:...:.|.:.::|......:.|.....|
  Fly   850 WYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKF 914

  Fly    87 NS--VVEMINYYKENSLS------MYNK----TLDITLSNPIVRAREDEESQPHGDLC------- 132
            .|  :.|.|....|:|.|      ::.:    .:.:.|:||:.|.:..:..|   .:|       
  Fly   915 KSQTITEFIEKAVEHSRSGRYLF
FLHRRPEHGPMRVQLTNPVSRFKHVQSLQ---HMCRFVILKA 976

  Fly   133 LLSNEFIRTCQLLQNLEQNLENKRNSFNAIREELQEKKLHQSVFGN 178
            ::..:.|:|..|.:.|...|..|    :...|:::....|..:.|:
  Fly   977 VIRKDLIQTLPLPRRLLDYLNYK----HCYSEQVESDSSHSQISGD 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pi3K21BNP_001259817.1 SH2_nSH2_p85_like 14..123 CDD:198195 31/112 (28%)
PI3K_P85_iSH2 129..302 CDD:293063 10/57 (18%)
iSH2_PI3K_IA_R 138..303 CDD:304922 9/41 (22%)
SH2_cSH2_p85_like 320..422 CDD:198184
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 27/86 (31%)
SOCS_SOCS7 960..1009 CDD:239710 9/55 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10155
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.