DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stip1 and si:dkey-33c12.4

DIOPT Version :9

Sequence 1:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_021336269.1 Gene:si:dkey-33c12.4 / 560112 ZFINID:ZDB-GENE-030131-2527 Length:648 Species:Danio rerio


Alignment Length:463 Identity:101/463 - (21%)
Similarity:173/463 - (37%) Gaps:137/463 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SNRSAAFAKAGKFQEALEDAEKTIQLNPTWPKGYSRKGAAAAGLND--FMKAFEAYNEGLKYDPT 104
            |.|....||.||      :.||.::|     |.|...      .||  .|:..||..:.:...|.
Zfish     8 SERCVVCAKVGK------NLEKRVRL-----KDYFLL------QNDERLMRTHEAMVDMINDRPA 55

  Fly   105 NAILLQGRMETTASALSF-----------------MQSQGD---IPMDVDPQQARS--------- 140
            |..:|        .||||                 .:...|   ...|.|...:.:         
Zfish    56 NRNIL--------DALSFGYKYVPELDHFAAQFPGYEDSSDEDYYYYDDDKYSSHTNNRYCGFSR 112

  Fly   141 ----RRAPSPPPAKPAEPPK----PAEPRVEDMTEEQKNKYFARKEKELGNAAYKKKDFETALKH 197
                |..|.|..|:.||...    ..|.:::...|::|.|...:||:.    ..:|.:.|.|.|.
Zfish   113 NFLDRGLPKPITAEEAERNAKELVDEEEKIKKKAEKKKMKKMRQKERR----RLEKLEKENANKE 173

  Fly   198 YHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCE-KGIE-------------VGRESRADFKL 248
            .:..::.||      ......|.: |:.|...|:|: ||..             ...:|.:|.:.
Zfish   174 KNKPVQVDP------GPEKTKHAD-KDNENKDKKCKNKGCSSVPPDPQPISAPVSSSDSSSDEED 231

  Fly   249 IAKSFARIGNTYRKLENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEE 313
            ..|..:.|     :.|.......:...|.:        .:..::|.|.|.:::.|..||:|..|.
Zfish   232 DKKEDSAI-----EPEELDMNSCFVSNAAA--------IAKRKLEQKPKPDKKPAQANPKKQHES 283

  Fly   314 KEQ-----------------------------------GNLFFKKGDYSTAVKHYTEAIKRNPDD 343
            :::                                   ||.:...|:...|||::|:|||.||.:
Zfish   284 QQKATVMPQKQVAKEEVNGEESVNANDFITRSVELAVIGNEYAGSGNMEMAVKYFTDAIKHNPKE 348

  Fly   344 PKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELD 408
            .||:.||:.||.|:..::..|.|.:..:.::.|:|||..|||:.|.|:::.::|:..:.:.|:||
Zfish   349 YKLFGNRSYCYEKMLQYEKSLTDAEIALSMNPKWIKGLYRKGRALVGLKRYNEARLTFGEVLKLD 413

  Fly   409 PNNAEAIE 416
            .:..:|.|
Zfish   414 SSCKDAAE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stip1NP_477354.1 TPR_11 6..69 CDD:290150 9/26 (35%)
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809 8/24 (33%)
TPR_11 40..103 CDD:290150 16/62 (26%)
TPR repeat 72..100 CDD:276809 7/29 (24%)
TPR_11 175..237 CDD:290150 15/62 (24%)
TPR repeat 175..203 CDD:276809 6/27 (22%)
TPR_1 181..208 CDD:278916 6/26 (23%)
TPR_12 205..278 CDD:290160 15/86 (17%)
TPR repeat 208..238 CDD:276809 7/43 (16%)
TPR repeat 250..278 CDD:276809 4/27 (15%)
TPR_1 250..>276 CDD:278916 3/25 (12%)
TPR_11 309..375 CDD:290150 23/100 (23%)
TPR repeat 310..338 CDD:276809 9/62 (15%)
TPR_1 <317..343 CDD:278916 12/25 (48%)
TPR repeat 343..373 CDD:276809 9/29 (31%)
TPR_1 378..411 CDD:278916 12/32 (38%)
TPR repeat 378..406 CDD:276809 9/27 (33%)
STI1 439..478 CDD:128966
si:dkey-33c12.4XP_021336269.1 PLN03088 258..>439 CDD:330826 44/164 (27%)
TPR repeat 348..378 CDD:276809 9/29 (31%)
TPR repeat 383..411 CDD:276809 9/27 (33%)
UBA 430..456 CDD:270456
RRM <471..>614 CDD:223796
RRM 519..584 CDD:214636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001589
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.