DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stip1 and CG6980

DIOPT Version :9

Sequence 1:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:156 Identity:48/156 - (30%)
Similarity:74/156 - (47%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEEKEQGNLFFKKGDYST 328
            :|.||.|...:|:..|...   |.:....||:.|.|        .:||.::.|||..|:...|..
  Fly    93 DNEKQVKDMNQKSFMEQVE---KDANDRAEARAKAE--------YEAELQRSQGNEAFRSQKYEK 146

  Fly   329 AVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCI-KLDEKFIKGYIRKGKILQGMQ 392
            |:.||.:||.:..|....|.|||.||.||..:...||||...: ||.|..::.::.:....:|::
  Fly   147 AILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLK 211

  Fly   393 QQSKAQAAYQKALELDPNNAEAIEGY 418
            |..|.:.:..||.|.:|.....|:.|
  Fly   212 QDDKFEESVVKAREHNPKQLAYIDKY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stip1NP_477354.1 TPR_11 6..69 CDD:290150
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 175..237 CDD:290150
TPR repeat 175..203 CDD:276809
TPR_1 181..208 CDD:278916
TPR_12 205..278 CDD:290160 5/13 (38%)
TPR repeat 208..238 CDD:276809
TPR repeat 250..278 CDD:276809 5/13 (38%)
TPR_1 250..>276 CDD:278916 4/11 (36%)
TPR_11 309..375 CDD:290150 27/66 (41%)
TPR repeat 310..338 CDD:276809 11/27 (41%)
TPR_1 <317..343 CDD:278916 9/25 (36%)
TPR repeat 343..373 CDD:276809 12/30 (40%)
TPR_1 378..411 CDD:278916 7/32 (22%)
TPR repeat 378..406 CDD:276809 5/27 (19%)
STI1 439..478 CDD:128966
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 25/62 (40%)
TPR repeat 128..156 CDD:276809 11/27 (41%)
TPR repeat 161..192 CDD:276809 12/30 (40%)
TPR_1 162..190 CDD:278916 12/27 (44%)
TPR repeat 197..225 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.