DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stip1 and Tom70

DIOPT Version :9

Sequence 1:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster


Alignment Length:584 Identity:106/584 - (18%)
Similarity:199/584 - (34%) Gaps:188/584 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVNELKEKGNQALSAEKFDEAVAAYTEAIALDDQNH-----VLYSNRSAAFAKAGKFQEALED 60
            :.:.|..|.:||......|:|||:..|.:||....:.|     :.|.||:|::....|:....||
  Fly    87 LKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKED 151

  Fly    61 AEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQ--GRMETTASALSFM 123
            ...:::.||.:.|.|.|:..|.....|.       ||.|. |.|...:|:  ...:|...|...:
  Fly   152 CTASLEFNPRYAKAYYRRARAHEATKDM-------NECLD-DVTATCILEMFQNNQTIMFADRVL 208

  Fly   124 QSQGDIPMDVDPQQARSRRAPSPPP------------AKPAEPPKPAEPRVEDMTEEQKNKYFAR 176
            :..|.:    |.::....|.|..|.            |.|.:..|...|:     .:...|.|.|
  Fly   209 KETGRL----DAEKGMRNRVPVVPSACFVNTYTRSFIADPLQTMKVPAPK-----SDAPPKGFLR 264

  Fly   177 KEKELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGRE 241
                                                   |.:.|..::|||.|..|.:.|| ..|
  Fly   265 ---------------------------------------AHLAFLEEKYEEIIPACTEEIE-SSE 289

  Fly   242 SRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAM-SEHRTPEIKTSLSEVEAKIKEEERMAYI 305
            :.|.:|:  ::....|..:....:|.:::..::..: :::..|.::.              .|||
  Fly   290 AEAQYKV--EALLMRGTFHLLCGSYVESQQDFDAIIANDYADPNLRA--------------YAYI 338

  Fly   306 NPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTC 370
                     ::..|:.:.......:..:.||.:.||::|.:|..||.....|...:..|.:.:..
  Fly   339 ---------KRAALYIQLDQREKGIADFAEAERLNPENPDVYHQRAQILLLLEQIEPALAEFEKA 394

  Fly   371 IKLD--------------------------------------EKF---IKGYIRKGKILQGMQQQ 394
            :.:.                                      |:|   ::.|....::|...||.
  Fly   395 VSIAPNHAIAFVQKCYAEYRLSLLAGDQRRLESVMHTFQNAIERFPSCVECYSLTAQVLADQQQF 459

  Fly   395 SKAQAAYQKALELDPNNA-------------------------EAIEGYRQCSMNF--------Q 426
            ::|:..|:||:.|.|.|.                         :|||...:|.:.:        |
  Fly   460 TQAEEYYKKAMVLAPTNPALIVHQAIMVLQWRGDINLAVQLLNKAIEVDPKCELAYETLGTVEVQ 524

  Fly   427 RNP--------QEVLKNAMSDPEIQQI--LKDPAMRMI--LEQMQSDPNAVKEHLQNPAIADKI 478
            |..        ::.|..|.|..|:..:  |::.|:..|  .:::..|.|:|....|:..:|..:
  Fly   525 RAQLTRAVELFEKALLYAKSQAELVHVYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGV 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stip1NP_477354.1 TPR_11 6..69 CDD:290150 18/67 (27%)
TPR repeat 7..32 CDD:276809 9/24 (38%)
TPR repeat 37..67 CDD:276809 8/34 (24%)
TPR_11 40..103 CDD:290150 17/62 (27%)
TPR repeat 72..100 CDD:276809 7/27 (26%)
TPR_11 175..237 CDD:290150 8/61 (13%)
TPR repeat 175..203 CDD:276809 1/27 (4%)
TPR_1 181..208 CDD:278916 0/26 (0%)
TPR_12 205..278 CDD:290160 14/73 (19%)
TPR repeat 208..238 CDD:276809 8/29 (28%)
TPR repeat 250..278 CDD:276809 2/28 (7%)
TPR_1 250..>276 CDD:278916 2/25 (8%)
TPR_11 309..375 CDD:290150 11/103 (11%)
TPR repeat 310..338 CDD:276809 3/27 (11%)
TPR_1 <317..343 CDD:278916 5/25 (20%)
TPR repeat 343..373 CDD:276809 6/29 (21%)
TPR_1 378..411 CDD:278916 10/32 (31%)
TPR repeat 378..406 CDD:276809 8/27 (30%)
STI1 439..478 CDD:128966 9/42 (21%)
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 19/70 (27%)
TPR repeat 90..118 CDD:276809 10/27 (37%)
TPR repeat 123..158 CDD:276809 8/34 (24%)
TPR repeat 296..324 CDD:276809 2/29 (7%)
TPR_11 333..399 CDD:290150 14/88 (16%)
TPR repeat 334..362 CDD:276809 6/50 (12%)
TPR repeat 367..397 CDD:276809 6/29 (21%)
TPR repeat 402..437 CDD:276809 0/34 (0%)
TPR_16 413..477 CDD:290168 12/63 (19%)
TPR repeat 443..471 CDD:276809 8/27 (30%)
TPR repeat 476..507 CDD:276809 3/30 (10%)
TPR_11 486..539 CDD:290150 6/52 (12%)
TPR repeat 512..539 CDD:276809 2/26 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.