DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Stip1 and STUB1

DIOPT Version :9

Sequence 1:	NP_477354.1	Gene:	Stip1 / 33202	FlyBaseID:	FBgn0024352	Length:	490	Species:	Drosophila melanogaster
Sequence 2:	NP_477441.1	Gene:	STUB1 / 34433	FlyBaseID:	FBgn0027052	Length:	289	Species:	Drosophila melanogaster

Alignment Length:	138	Identity:	38/138 - (27%)
Similarity:	62/138 - (44%)	Gaps:	17/138 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   314 KEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFI 378
            |||||..|....|..|:..|::||.:||.:...::|||.|..||..::|..:|....:.:|...:
  Fly    18 KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGNLL 82

  Fly   379 KGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMNF-------QRNPQEVLKNA 436
            ||:...|:.|..:....:|....|:|.:|.          ::...||       .|..::...|.
  Fly    83 KGHFFLGQGLMEIDNFDEAIKHLQRAYDLS----------KEQKQNFGDDITLQLRLARKKRWNV 137

  Fly   437 MSDPEIQQ 444
            |.:..|||
  Fly   138 MEEKRIQQ 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Stip1	NP_477354.1	TPR_11	6..69	CDD:290150
		TPR repeat	7..32	CDD:276809
		TPR repeat	37..67	CDD:276809
		TPR_11	40..103	CDD:290150
		TPR repeat	72..100	CDD:276809
		TPR_11	175..237	CDD:290150
		TPR repeat	175..203	CDD:276809
		TPR_1	181..208	CDD:278916
		TPR_12	205..278	CDD:290160
		TPR repeat	208..238	CDD:276809
		TPR repeat	250..278	CDD:276809
		TPR_1	250..>276	CDD:278916
		TPR_11	309..375	CDD:290150	21/60 (35%)
		TPR repeat	310..338	CDD:276809	10/23 (43%)
		TPR_1	<317..343	CDD:278916	10/25 (40%)
		TPR repeat	343..373	CDD:276809	8/29 (28%)
		TPR_1	378..411	CDD:278916	8/32 (25%)
		TPR repeat	378..406	CDD:276809	7/27 (26%)
		STI1	439..478	CDD:128966	3/6 (50%)
STUB1	NP_477441.1	TPR_11	17..78	CDD:290150	21/59 (36%)
		TPR	17..47	CDD:197478	13/28 (46%)
		TPR repeat	17..42	CDD:276809	10/23 (43%)
		TPR repeat	47..77	CDD:276809	8/29 (28%)
		TPR repeat	82..110	CDD:276809	7/27 (26%)
		U-box	213..285	CDD:252675
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45462448
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840