Sequence 1: | NP_477354.1 | Gene: | Stip1 / 33202 | FlyBaseID: | FBgn0024352 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_570074.3 | Gene: | HIP / 318211 | FlyBaseID: | FBgn0260484 | Length: | 377 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 64/262 - (24%) |
---|---|---|---|
Similarity: | 106/262 - (40%) | Gaps: | 61/262 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKVNELKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALEDAEKTI 65
Fly 66 QLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYD---PTNAILLQGRMETTASALSFMQSQG 127
Fly 128 DIPMDVDPQQARSRRAPSPPPAKPAEPPKPAEPRVEDMTEEQKNKYFARKEKELGNAAY------ 186
Fly 187 ---------KKKDFETALK--HYHAAIE---HDPTDITFYNNIAAVHFERKEYEECIKQCEKGIE 237
Fly 238 VG 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Stip1 | NP_477354.1 | TPR_11 | 6..69 | CDD:290150 | 22/62 (35%) |
TPR repeat | 7..32 | CDD:276809 | 11/24 (46%) | ||
TPR repeat | 37..67 | CDD:276809 | 7/29 (24%) | ||
TPR_11 | 40..103 | CDD:290150 | 18/65 (28%) | ||
TPR repeat | 72..100 | CDD:276809 | 8/27 (30%) | ||
TPR_11 | 175..237 | CDD:290150 | 19/81 (23%) | ||
TPR repeat | 175..203 | CDD:276809 | 11/44 (25%) | ||
TPR_1 | 181..208 | CDD:278916 | 8/46 (17%) | ||
TPR_12 | 205..278 | CDD:290160 | 9/35 (26%) | ||
TPR repeat | 208..238 | CDD:276809 | 6/29 (21%) | ||
TPR repeat | 250..278 | CDD:276809 | |||
TPR_1 | 250..>276 | CDD:278916 | |||
TPR_11 | 309..375 | CDD:290150 | |||
TPR repeat | 310..338 | CDD:276809 | |||
TPR_1 | <317..343 | CDD:278916 | |||
TPR repeat | 343..373 | CDD:276809 | |||
TPR_1 | 378..411 | CDD:278916 | |||
TPR repeat | 378..406 | CDD:276809 | |||
STI1 | 439..478 | CDD:128966 | |||
HIP | NP_570074.3 | Hip_N | 10..47 | CDD:271228 | |
TPR_11 | 125..190 | CDD:290150 | 21/64 (33%) | ||
TPR_2 | 126..159 | CDD:285020 | 14/32 (44%) | ||
TPR repeat | 126..154 | CDD:276809 | 12/27 (44%) | ||
TPR repeat | 159..189 | CDD:276809 | 7/29 (24%) | ||
TPR repeat | 194..222 | CDD:276809 | 8/27 (30%) | ||
STI1 | 299..336 | CDD:128966 | 9/43 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462457 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |