DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stip1 and Tomm34

DIOPT Version :9

Sequence 1:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001037709.1 Gene:Tomm34 / 311621 RGDID:1309029 Length:309 Species:Rattus norvegicus


Alignment Length:432 Identity:92/432 - (21%)
Similarity:148/432 - (34%) Gaps:140/432 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKVNELKEKGNQALSAEKFDEAVAAYTEAIAL--------DDQNHVLYSNRSAAFAKAGKFQEAL 58
            |.|.:|:..|||.....::.||.|.|..|:.|        .::..||||||:|.:.|.|...:.:
  Rat     7 DSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCI 71

  Fly    59 EDAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQGRMETTASALSFM 123
            :|....:.|.|...|...|:.:|...|..:..|:..|...|:.|.:.|..|:|....|.   :.|
  Rat    72 KDCTSALALVPFSIKPLLRRASAYEALEKYSLAYVDYKTVLQIDNSVASALEGINRITR---ALM 133

  Fly   124 QSQGDIPMDVDPQQARSRRAPSPP-PAKPAEPPKPAEPRVEDMTEEQKNKYFARKEKELGNAAYK 187
            .|.|       |:.    |...|| |..|..    |:.|...:..|...:....|.||       
  Rat   134 DSLG-------PEW----RLKLPPIPVVPVS----AQKRWSSLPSENHKETAKSKSKE------- 176

  Fly   188 KKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGRESRADFKLIAKS 252
                .||.|                                                        
  Rat   177 ----TTATK-------------------------------------------------------- 181

  Fly   253 FARIGNTYRKLENYKQAKVYYEKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEEKEQG 317
                                       :|.|    |..:|               |:|...||:|
  Rat   182 ---------------------------NRVP----SAGDV---------------ERARVLKEEG 200

  Fly   318 NLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYI 382
            |...|||::..|::.|:|::..:..:...|||||.|:..|..:....|||...:|||.|.:|.:.
  Rat   201 NELVKKGNHKKAIEKYSESLLFSSLESATYSNRALCHLVLKQYKEAEKDCTEALKLDGKNVKAFY 265

  Fly   383 RKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMN 424
            |:.:..:.::....:.|.....|:::|.|..|.:..::.:.|
  Rat   266 RRAQAYKALKDYKSSLADISSLLQIEPRNGPAHKLRQEVNQN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stip1NP_477354.1 TPR_11 6..69 CDD:290150 21/70 (30%)
TPR repeat 7..32 CDD:276809 9/24 (38%)
TPR repeat 37..67 CDD:276809 10/29 (34%)
TPR_11 40..103 CDD:290150 18/62 (29%)
TPR repeat 72..100 CDD:276809 6/27 (22%)
TPR_11 175..237 CDD:290150 6/61 (10%)
TPR repeat 175..203 CDD:276809 6/27 (22%)
TPR_1 181..208 CDD:278916 3/26 (12%)
TPR_12 205..278 CDD:290160 0/72 (0%)
TPR repeat 208..238 CDD:276809 0/29 (0%)
TPR repeat 250..278 CDD:276809 0/27 (0%)
TPR_1 250..>276 CDD:278916 0/25 (0%)
TPR_11 309..375 CDD:290150 23/65 (35%)
TPR repeat 310..338 CDD:276809 11/27 (41%)
TPR_1 <317..343 CDD:278916 8/25 (32%)
TPR repeat 343..373 CDD:276809 10/29 (34%)
TPR_1 378..411 CDD:278916 5/32 (16%)
TPR repeat 378..406 CDD:276809 3/27 (11%)
STI1 439..478 CDD:128966
Tomm34NP_001037709.1 TPR repeat 261..289 CDD:276809 3/27 (11%)
TPR 6 262..294 5/31 (16%)
TPR 1 9..42 11/32 (34%)
TPR repeat 9..37 CDD:276809 10/27 (37%)
3a0801s09 <11..>294 CDD:273380 87/413 (21%)
TPR repeat 50..80 CDD:276809 10/29 (34%)
TPR 2 51..84 12/32 (38%)
TPR repeat 85..113 CDD:276809 6/27 (22%)
TPR 3 86..118 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..187 9/126 (7%)
TPR 4 193..226 11/32 (34%)
TPR repeat 193..221 CDD:276809 11/27 (41%)
TPR repeat 226..256 CDD:276809 10/29 (34%)
TPR 5 227..260 13/32 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53129
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.