DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stip1 and STIP1

DIOPT Version :9

Sequence 1:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001269581.1 Gene:STIP1 / 10963 HGNCID:11387 Length:590 Species:Homo sapiens


Alignment Length:544 Identity:272/544 - (50%)
Similarity:348/544 - (63%) Gaps:63/544 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNELKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALEDAEKTIQLN 68
            |||||||||:|||....|:|:..|:|||.||..|||||||||||:||.|.:|:|.||..||:.|.
Human    51 VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLK 115

  Fly    69 PTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDPTNAILLQG--RMETTASALSFMQSQGDIP- 130
            |.|.||||||.||...||.|.:|...|.||||::..|..|.:|  .||...:...|| :..::| 
Human   116 PDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFM-NPFNMPN 179

  Fly   131 ----MDVDP---------------QQARSRR---------------------------------A 143
                ::.||               :|.|::.                                 |
Human   180 LYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIA 244

  Fly   144 PSPPPAKPAEPPKPAEPRVEDMTEEQKNKYFARKEKELGNAAYKKKDFETALKHYHAAIEHDPTD 208
            ..|||..|.:..|| ||..||:.|   ||..|.|||||||.|||||||:||||||..|.|.|||:
Human   245 TPPPPPPPKKETKP-EPMEEDLPE---NKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTN 305

  Fly   209 ITFYNNIAAVHFERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYY 273
            :|:..|.|||:||:.:|.:|.:.|||.||||||:|.|::.|||::|||||:|.|.|.||.|..:|
Human   306 MTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFY 370

  Fly   274 EKAMSEHRTPEIKTSLSEVEAKIKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIK 338
            .|:::|||||::.....:.|..:||:||:|||||:.|.|||.:||..|:||||..|:||||||||
Human   371 NKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIK 435

  Fly   339 RNPDDPKLYSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQK 403
            |||.|.|||||||||||||..|.|.||||:.||:|:..|||||.||...|:.|:..:||...|||
Human   436 RNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQK 500

  Fly   404 ALELDPNNAEAIEGYRQCSM---NFQRNPQEVLKNAMSDPEIQQILKDPAMRMILEQMQSDPNAV 465
            ||:||.:..||.:||::|.|   |...:|::|.:.||:|||:|||:.|||||:||||||.||.|:
Human   501 ALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQAL 565

  Fly   466 KEHLQNPAIADKIMKLLESGIIQI 489
            .|||:||.||.||.||::.|:|.|
Human   566 SEHLKNPVIAQKIQKLMDVGLIAI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stip1NP_477354.1 TPR_11 6..69 CDD:290150 39/62 (63%)
TPR repeat 7..32 CDD:276809 14/24 (58%)
TPR repeat 37..67 CDD:276809 20/29 (69%)
TPR_11 40..103 CDD:290150 37/62 (60%)
TPR repeat 72..100 CDD:276809 15/27 (56%)
TPR_11 175..237 CDD:290150 38/61 (62%)
TPR repeat 175..203 CDD:276809 22/27 (81%)
TPR_1 181..208 CDD:278916 20/26 (77%)
TPR_12 205..278 CDD:290160 39/72 (54%)
TPR repeat 208..238 CDD:276809 13/29 (45%)
TPR repeat 250..278 CDD:276809 15/27 (56%)
TPR_1 250..>276 CDD:278916 14/25 (56%)
TPR_11 309..375 CDD:290150 46/65 (71%)
TPR repeat 310..338 CDD:276809 18/27 (67%)
TPR_1 <317..343 CDD:278916 19/25 (76%)
TPR repeat 343..373 CDD:276809 22/29 (76%)
TPR_1 378..411 CDD:278916 17/32 (53%)
TPR repeat 378..406 CDD:276809 14/27 (52%)
STI1 439..478 CDD:128966 27/38 (71%)
STIP1NP_001269581.1 PLN03088 <54..579 CDD:330826 263/529 (50%)
TPR repeat 54..79 CDD:276809 14/24 (58%)
TPR repeat 84..114 CDD:276809 20/29 (69%)
TPR repeat 119..147 CDD:276809 15/27 (56%)
TPR repeat 276..300 CDD:276809 19/23 (83%)
TPR repeat 305..335 CDD:276809 13/29 (45%)
TPR repeat 347..375 CDD:276809 15/27 (56%)
TPR repeat 411..435 CDD:276809 15/23 (65%)
TPR repeat 440..470 CDD:276809 22/29 (76%)
TPR repeat 475..503 CDD:276809 14/27 (52%)
TPR repeat 509..538 CDD:276809 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8929
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4965
Inparanoid 1 1.050 490 1.000 Inparanoid score I1430
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D387926at33208
OrthoFinder 1 1.000 - - FOG0001589
OrthoInspector 1 1.000 - - oto89891
orthoMCL 1 0.900 - - OOG6_102012
Panther 1 1.100 - - LDO PTHR22904
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1407
SonicParanoid 1 1.000 - - X2280
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.