| Sequence 1: | NP_477354.1 | Gene: | Stip1 / 33202 | FlyBaseID: | FBgn0024352 | Length: | 490 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
| Alignment Length: | 328 | Identity: | 82/328 - (25%) |
|---|---|---|---|
| Similarity: | 130/328 - (39%) | Gaps: | 75/328 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 160 PRVEDMTEEQK---NKYFARKEKELGNAAYKKKDFETALKHYHAAIEHDP-TDITFYNNIAAVHF 220
Fly 221 ERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYE----------- 274
Fly 275 ---------KAMSEHRTPEIKTSLSEVE---------------------AKIKEEERMAYIN--- 306
Fly 307 ----PEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDC 367
Fly 368 DTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMNFQRNPQEV 432
Fly 433 LKN 435 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Stip1 | NP_477354.1 | TPR_11 | 6..69 | CDD:290150 | |
| TPR repeat | 7..32 | CDD:276809 | |||
| TPR repeat | 37..67 | CDD:276809 | |||
| TPR_11 | 40..103 | CDD:290150 | |||
| TPR repeat | 72..100 | CDD:276809 | |||
| TPR_11 | 175..237 | CDD:290150 | 16/62 (26%) | ||
| TPR repeat | 175..203 | CDD:276809 | 5/27 (19%) | ||
| TPR_1 | 181..208 | CDD:278916 | 7/27 (26%) | ||
| TPR_12 | 205..278 | CDD:290160 | 22/93 (24%) | ||
| TPR repeat | 208..238 | CDD:276809 | 9/29 (31%) | ||
| TPR repeat | 250..278 | CDD:276809 | 10/47 (21%) | ||
| TPR_1 | 250..>276 | CDD:278916 | 9/45 (20%) | ||
| TPR_11 | 309..375 | CDD:290150 | 25/65 (38%) | ||
| TPR repeat | 310..338 | CDD:276809 | 11/27 (41%) | ||
| TPR_1 | <317..343 | CDD:278916 | 8/25 (32%) | ||
| TPR repeat | 343..373 | CDD:276809 | 11/29 (38%) | ||
| TPR_1 | 378..411 | CDD:278916 | 5/32 (16%) | ||
| TPR repeat | 378..406 | CDD:276809 | 3/27 (11%) | ||
| STI1 | 439..478 | CDD:128966 | |||
| TOMM34 | NP_006800.2 | TPR 1 | 9..42 | 8/37 (22%) | |
| TPR repeat | 9..37 | CDD:276809 | 7/32 (22%) | ||
| PLN03088 | <12..>294 | CDD:330826 | 71/293 (24%) | ||
| TPR repeat | 50..80 | CDD:276809 | 9/29 (31%) | ||
| TPR 2 | 51..84 | 9/37 (24%) | |||
| TPR repeat | 85..113 | CDD:276809 | 9/29 (31%) | ||
| TPR 3 | 86..118 | 9/31 (29%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 6/27 (22%) | |||
| TPR 4 | 193..226 | 11/32 (34%) | |||
| TPR repeat | 193..221 | CDD:276809 | 11/27 (41%) | ||
| TPR repeat | 226..256 | CDD:276809 | 11/29 (38%) | ||
| TPR 5 | 227..260 | 14/32 (44%) | |||
| TPR repeat | 261..289 | CDD:276809 | 3/27 (11%) | ||
| TPR 6 | 262..294 | 5/31 (16%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165155697 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53129 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.850 | |||||