DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and ZRSR2

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_016885370.1 Gene:ZRSR2 / 8233 HGNCID:23019 Length:486 Species:Homo sapiens


Alignment Length:333 Identity:92/333 - (27%)
Similarity:134/333 - (40%) Gaps:115/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYV------------NPQNSAKSADG 64
            |||:.||.||.|.||||.||||||.||.||.|.|:|:::::.            :|..|.:    
Human   166 EKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLE---- 226

  Fly    65 SHLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAA 129
                  .|:||..:.:.:|:|||..|.:: .|::.:..|..||..||.||||:::::|.:.:.|.
Human   227 ------YSEEETYQQFLDFYEDVLPEFKN-VGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAAL 284

  Fly   130 NDLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHL------------------ 176
            :..|.||:.||.:..|..|||.::.|.|..:|:.:|.|...|||:|:                  
Human   285 SLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLS 349

  Fly   177 -----------------------------------------------------------KPISRE 182
                                                                       |..|:.
Human   350 PDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKS 414

  Fly   183 LRRYLYSRRRRARSRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDR 247
            ..|:....|.|.|.|||...|.|||||||||..||               :.|...:.:.|...|
Human   415 RERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRR---------------SRRSRSQSSSRSRSR 464

  Fly   248 DRRKGGGG 255
            .||:...|
Human   465 GRRRSETG 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 18/25 (72%)
RRM_U2AF35 43..148 CDD:240982 31/116 (27%)
zf-CCCH 151..177 CDD:279036 9/102 (9%)
ZRSR2XP_016885370.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.