DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and u2af1

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001039113.1 Gene:u2af1 / 733934 XenbaseID:XB-GENE-877053 Length:243 Species:Xenopus tropicalis


Alignment Length:263 Identity:188/263 - (71%)
Similarity:203/263 - (77%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65
            |||||||||||||||||||||||||||||||||||:|||||||||:.|.|:|.|||||::|||| 
 Frog     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADG- 64

  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130
             |...|||.|||||||.|||:||.|.|:||||:||||||||||||||||||:|||.|.|||||..
 Frog    65 -LRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVK 128

  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRAR 195
            |||||||.|:|:::|||||||||||||||||||||||.|||||||||||||||||.||.|||: :
 Frog   129 DLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRK-K 192

  Fly   196 SRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDRDRRKGGGGGGGGG 260
            ||.|        |||||..||.|||.|   |||.                      |||||||||
 Frog   193 SRER--------RSRSRDRGRGGGGGG---GGGG----------------------GGGGGGGGG 224

  Fly   261 GGR 263
            |||
 Frog   225 GGR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 24/25 (96%)
RRM_U2AF35 43..148 CDD:240982 75/104 (72%)
zf-CCCH 151..177 CDD:279036 24/25 (96%)
u2af1NP_001039113.1 zf-CCCH 13..37 CDD:366217 23/23 (100%)
RRM_U2AF35 43..146 CDD:240982 75/104 (72%)
zf-CCCH 149..173 CDD:366217 22/23 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7313
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H14345
Inparanoid 1 1.050 373 1.000 Inparanoid score I2070
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 1 1.000 - - FOG0002537
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1660
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.