DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and Zrsr1

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001017504.1 Gene:Zrsr1 / 498425 RGDID:1561824 Length:428 Species:Rattus norvegicus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:127/264 - (48%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGSHLVANV--SDE 74
            ||.:.:|.||.|.||||.|:||||.|:.||.|.|:|:::::..........|.....||:  |:|
  Rat   158 EKYRPSCPFYNKTGACRFGNRCSRKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYSEE 222

  Fly    75 EMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAANDLNNRWFGG 139
            |..:.:.:|:.||..|.:: .|::.:..|..||..||.||||:::::|.:.:.|.:..|.||:.|
  Rat   223 ETYQQFLDFYHDVLPEFKN-VGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAG 286

  Fly   140 RPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMH-----------------LKPIS------- 180
            |.:..|..|||.::.|.|..:||.:|.:...|||:|                 |.|.|       
  Rat   287 RQLQCEFCPVTRWKVAICGLFEMQKCPKGKHCNFLHVFRNPNNEFRDANRDIYLPPASTGSSGKN 351

  Fly   181 ------RELRRYLYSRRR-----------RAR-SRSRSPGR-----RRGSRSRSRSPGRRGGGRG 222
                  ::.|...||:.|           |:| |..:||.|     ::.::|..|...|||...|
  Rat   352 SDRGDRKDHREESYSKSRSHHSGSYHSSKRSRESERKSPHRWKKSHKQATKSHERHSSRRGREEG 416

  Fly   223 DGVG 226
            ...|
  Rat   417 SSPG 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 15/25 (60%)
RRM_U2AF35 43..148 CDD:240982 31/106 (29%)
zf-CCCH 151..177 CDD:279036 9/42 (21%)
Zrsr1NP_001017504.1 zf-CCCH 159..184 CDD:279036 14/24 (58%)
RRM_U2AFBPL 191..295 CDD:240984 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.