DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and CG3294

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_608857.2 Gene:CG3294 / 33677 FlyBaseID:FBgn0031628 Length:456 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:123/279 - (44%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAK-------S 61
            :|..:..|..::..|.|:.:...||:|..|:..|.:|...:.:|:::.:.:.....:       |
  Fly   156 HLLRVMETHPEERACEFFSRTNCCRYGHACTFNHRRPMLGRILLIRHFFNHSMLQKRCTHKEYAS 220

  Fly    62 ADGSHLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAE 126
            |: .||  .:::::::..||.||.||..|.. |:|.|.......|..:||.|:|::::.||..|.
  Fly   221 AE-EHL--ELTEQDLRHDYDEFFNDVVEELR-KFGTIVNFRTVRNTLEHLRGHVFVEYTNERSAL 281

  Fly   127 KAANDLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHL--KP---ISRELRRY 186
            :|..:|..|::..:.:..|.|.:..:|.|.|......:|.:...|.::||  .|   .:.|| .|
  Fly   282 RAFTNLQGRYYASKRLNVEFSNLRTWRGAVCGLSLTRKCPKGNDCGYLHLFGNPNNLFNTEL-EY 345

  Fly   187 LYSRRRRARSRSRSPGRRRGSRSRSRSPGRR-----------GGGRGDGVGGGNYLNNERDNMRG 240
            ....|...|| |::|..:..|.......||.           ...:..|..|.:..||::.|...
  Fly   346 TSGPRSERRS-SQTPTAKTPSWDEHSEHGRNWRWSASPEVELENSKDLGNRGRDLKNNQQRNHHS 409

  Fly   241 ---NDRGNDRDRRKGGGGG 256
               :||.:.|.:|:....|
  Fly   410 RSRSDRSSVRSKREHSSSG 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 7/25 (28%)
RRM_U2AF35 43..148 CDD:240982 27/111 (24%)
zf-CCCH 151..177 CDD:279036 7/27 (26%)
CG3294NP_608857.2 tolA_full <28..>123 CDD:274303
RRM_SF 197..303 CDD:302621 27/109 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2202
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1692
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.