DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and U2af1l4

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_739566.1 Gene:U2af1l4 / 233073 MGIID:2678374 Length:220 Species:Mus musculus


Alignment Length:220 Identity:167/220 - (75%)
Similarity:187/220 - (85%) Gaps:3/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65
            |||||||||||||||||||||||||||||||||||:|||||||||::|.|||.||||:|::||||
Mouse     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGS 65

  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130
            |  .:|||.|:|||||||||:||.|.::|||||||||||||||||||||||:|||.|.|||:|..
Mouse    66 H--CHVSDVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVA 128

  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRAR 195
            :||||||.|:.|::||||||||||:||||||||||||.||||||||:||||.|||.||.|..|.|
Mouse   129 ELNNRWFNGQAVHAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRNLRRQLYGRGPRHR 193

  Fly   196 SRSRS-PGRRRGSRSRSRSPGRRGG 219
            |..|| .|.|...|:|.|||..|.|
Mouse   194 SPPRSHTGHRPRERNRRRSPDHRHG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 24/25 (96%)
RRM_U2AF35 43..148 CDD:240982 74/104 (71%)
zf-CCCH 151..177 CDD:279036 23/25 (92%)
U2af1l4NP_739566.1 zf-CCCH 13..39 CDD:395517 24/25 (96%)
RRM_U2AF35 43..146 CDD:409954 74/104 (71%)
zf-CCCH 149..175 CDD:395517 23/25 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..220 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837920
Domainoid 1 1.000 94 1.000 Domainoid score I7453
eggNOG 1 0.900 - - E1_KOG2202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56320
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002537
OrthoInspector 1 1.000 - - otm43764
orthoMCL 1 0.900 - - OOG6_101418
Panther 1 1.100 - - O PTHR12620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.