DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2af38 and U2AF1L4

DIOPT Version :9

Sequence 1:NP_001259814.1 Gene:U2af38 / 33201 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_659424.2 Gene:U2AF1L4 / 199746 HGNCID:23020 Length:202 Species:Homo sapiens


Alignment Length:157 Identity:84/157 - (53%)
Similarity:95/157 - (60%) Gaps:41/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65
            |||||||||||||||||||||||||.|||||||||:||||||||                     
Human     1 MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQ--------------------- 44

  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130
                                :||.|.::|||||||||||||||||||||||:|||.|.|.|:|..
Human    45 --------------------EVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVA 89

  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACC 157
            :|:||||.|:.|:..:..|.......|
Human    90 ELSNRWFNGQAVHGNVPEVASATSCIC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 23/25 (92%)
RRM_U2AF35 43..148 CDD:240982 42/104 (40%)
zf-CCCH 151..177 CDD:279036 1/7 (14%)
U2AF1L4NP_659424.2 zf-CCCH 13..39 CDD:279036 23/25 (92%)
RRM_SF <41..102 CDD:302621 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147840
Domainoid 1 1.000 94 1.000 Domainoid score I7476
eggNOG 1 0.900 - - E1_KOG2202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1692
OMA 1 1.010 - - QHG56320
OrthoDB 1 1.010 - - D1340384at2759
OrthoFinder 1 1.000 - - FOG0002537
OrthoInspector 1 1.000 - - otm41715
orthoMCL 1 0.900 - - OOG6_101418
Panther 1 1.100 - - O PTHR12620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.670

Return to query results.
Submit another query.