DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and adtrp1

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001017719.1 Gene:adtrp1 / 550414 ZFINID:ZDB-GENE-050417-220 Length:241 Species:Danio rerio


Alignment Length:238 Identity:86/238 - (36%)
Similarity:133/238 - (55%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLHLTAVVQFGYGIYYDYNYVQFPTSEPEMRIHHP----WGGKFKYLTFLDAIIQALYY----IV 76
            |:||        |::..|.:..:.....:....||    :||::|||||::.::.|:::    :|
Zfish    14 LVHL--------GVFSWYLFTIWSNCSLQTADRHPGLRSYGGRWKYLTFINLVMHAVFFGLCVLV 70

  Fly    77 SLVNDFVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPS 141
            ..|:..|...:.....|..:.|.:|:....|||||...|.|:|||||..|||||:||:||.:.|.
Zfish    71 DAVHSAVSVKQSRSGTPLNLSRARDFYFTVLAFPVGTFVFVSFWTLYTYDRELVYPKLLDEIIPI 135

  Fly   142 WLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQ 206
            ||||.:||.|:..::|::|:....||.|:.|:..||:|:..||.|:..|.|.||:||||::..|.
Zfish   136 WLNHAMHTVIMPLLLLQMFLQNHRYPSRTAGIFSLAVFVALYLSWVLWVHHASGIWVYPIMAHLS 200

  Fly   207 LPQRILFFAAVVGFTLS---LYLLGEFLNNTVWAKEVKLAKRK 246
             |..:..|..  |.:||   ||||||.|:..:|:......|:|
Zfish   201 -PVGLCVFLG--GASLSMAPLYLLGEKLSLMMWSSTGNQKKKK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 83/223 (37%)
adtrp1NP_001017719.1 Far-17a_AIG1 13..226 CDD:282588 82/222 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592435
Domainoid 1 1.000 159 1.000 Domainoid score I4045
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134263
Inparanoid 1 1.050 164 1.000 Inparanoid score I4176
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm6435
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - LDO PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.