DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and AIG1

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001353273.1 Gene:AIG1 / 51390 HGNCID:21607 Length:285 Species:Homo sapiens


Alignment Length:267 Identity:80/267 - (29%)
Similarity:128/267 - (47%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLD------------------------------- 66
            |..:|..::.|:       |..:||.:|:|||:|                               
Human    20 ILCNYKAIEMPS-------HQTYGGSWKFLTFIDLMESHSVTRLECSGTISAHCNLCLLCSSYSP 77

  Fly    67 ----------------AIIQALYYIVSLVNDFVGT------NELTPKKPPAVRRFKDWLMATLAF 109
                            .:|||:::.:.::.|....      |:...::...:...:||::|.|||
Human    78 ASASRVAGTTGVCHHARVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAF 142

  Fly   110 PVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFISYRSYPKRSQGLA 174
            ||.:.|...||.:||.|||:::||:||...|.||||.:||.::.||::|:..|:..||.||.||.
Human   143 PVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLT 207

  Fly   175 GLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKE 239
            .:..|...|::|:..|.|.:|:||||.||.:....||:||.:.......||||||.|||.:|..:
Human   208 AICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQ 272

  Fly   240 VKLAKRK 246
            ..:.:.|
Human   273 KSMEEEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 76/252 (30%)
AIG1NP_001353273.1 Far-17a_AIG1 12..266 CDD:309749 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156794
Domainoid 1 1.000 167 1.000 Domainoid score I3862
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4081
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - otm40630
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.