DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and CG6149

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster


Alignment Length:221 Identity:96/221 - (43%)
Similarity:138/221 - (62%) Gaps:8/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RTLLHLTAVVQFGYGIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVNDF 82
            |...||:|.|..||.||:|..|.|.|.....:|:..|.||||||:|||..::|..||.::|..|.
  Fly    11 RLFFHLSATVHLGYAIYFDCRYAQLPQVAVTLRLEPPIGGKFKYMTFLCGLLQLGYYTLALTFDL 75

  Fly    83 VGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVL 147
            :....|        |:.:|::.||.|.|:|:.||:|||||:|||||:::|.:||.|:|:||||.:
  Fly    76 LRLRSL--------RKLRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTM 132

  Fly   148 HTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRIL 212
            ||.:|::..:||.|:...|||||:|..||..||..||||||:|...:.:||||.|..:....|::
  Fly   133 HTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLRVI 197

  Fly   213 FFAAVVGFTLSLYLLGEFLNNTVWAK 238
            ||..::......||.||.:||.:|.:
  Fly   198 FFVLIMVLGFIYYLFGERVNNVLWQR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 93/214 (43%)
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 93/214 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469170
Domainoid 1 1.000 159 1.000 Domainoid score I4045
eggNOG 1 0.900 - - E1_KOG3989
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4176
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm6435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
109.900

Return to query results.
Submit another query.