DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and Adtrp

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001014166.1 Gene:Adtrp / 361228 RGDID:1305679 Length:230 Species:Rattus norvegicus


Alignment Length:237 Identity:82/237 - (34%)
Similarity:129/237 - (54%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RTLLHLTAVVQFGYGIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVND- 81
            :|...|...|...:.|:.:|...|....|.:::..|. ||:.||||.|:.::||:::.|:.::| 
  Rat     3 KTTTCLYHFVVLNWYIFLNYYIPQIGKDEEKLKEFHD-GGRSKYLTLLNLLLQAVFFGVACLDDV 66

  Fly    82 ---FVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWL 143
               .:|..::     ..:..|:|.|..|||||::..|.:.||:|:..||.||:||.||..||:|:
  Rat    67 LKRVIGRKDI-----KFITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDDFFPAWV 126

  Fly   144 NHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLV---WIHVVKHYSGVWVYPVLEVL 205
            ||.:||:|..|.:.|..:...:||.:..||:.|.....||::   |.:|   .:|.|||||...|
  Rat   127 NHAMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYV---QTGNWVYPVFASL 188

  Fly   206 QLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAKRKS 247
            .....||||:|....:.||||.||.:|:..|...||...:|:
  Rat   189 SPLGIILFFSASYILSASLYLFGEKINHWKWGATVKPRMKKN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 77/221 (35%)
AdtrpNP_001014166.1 Far-17a_AIG1 5..216 CDD:368096 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350715
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.