DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and Aig1

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_006227704.1 Gene:Aig1 / 292486 RGDID:1562920 Length:268 Species:Rattus norvegicus


Alignment Length:221 Identity:81/221 - (36%)
Similarity:129/221 - (58%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTAVVQFGY-GIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVNDFVGT- 85
            |...:...| .|..:|..::.|:       |..:||.:|:|||:|.:|||:::.:.::.|.... 
  Rat     9 LRVAILLSYCSILCNYKAIEMPS-------HQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLL 66

  Fly    86 -----NELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNH 145
                 |:...::...:...:||.:|.|||||.:.|...|||:||.|||:::|::||...|.||||
  Rat    67 TRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNH 131

  Fly   146 VLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQR 210
            .:||.::.||::|:..|:..||.||.|||.:..|...|::|:..:.|.:|:||||.||.:....|
  Rat   132 GMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGAR 196

  Fly   211 ILFFAAVVGFTLSLYLLGEFLNNTVW 236
            |:||.:......|||||||.||:.:|
  Rat   197 IIFFGSTTLLMNSLYLLGEALNSYIW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 79/216 (37%)
Aig1XP_006227704.1 Far-17a_AIG1 12..219 CDD:282588 78/213 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350718
Domainoid 1 1.000 168 1.000 Domainoid score I3721
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I3977
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - otm44770
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.