DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and C37E2.3

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_510364.2 Gene:C37E2.3 / 183293 WormBaseID:WBGene00007995 Length:216 Species:Caenorhabditis elegans


Alignment Length:208 Identity:54/208 - (25%)
Similarity:99/208 - (47%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNYVQFPTSEPEMRIHHPWG-GKFKYLTFLDAIIQALYYIVSLVNDFVGTNELTPKKPPAVRRFK 100
            ::::|.|      |::|.|. .|...||.|..::..:|..:.::.          .|...::...
 Worm    22 FDFLQQP------RLNHSWYIYKLILLTNLAFVLNVVYSTLVVIG----------YKSKTIKEVV 70

  Fly   101 DWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFISYRS 165
            |::..|..||||:.:...||..|..|.:||.|..:..:.||||||:.||.::|||:|:.:...|.
 Worm    71 DFMHFTAMFPVAVILCGMFWGFYVYDSDLVMPAWVAEIVPSWLNHINHTYLIVFILLDSYYHKRD 135

  Fly   166 YPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLLGEF 230
            .|..|.......:::..|.:.:..||:|:.:||||||:               .|::.|:::...
 Worm   136 APSNSTSWMISVVYVTFYFIIVLGVKYYNRMWVYPVLQ---------------SFSIDLFVISYI 185

  Fly   231 LNNTVWAKEVKLA 243
            |:..::...:|.|
 Worm   186 LSVVIFFILLKAA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 52/196 (27%)
C37E2.3NP_510364.2 Far-17a_AIG1 5..203 CDD:309749 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.