DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and C37E2.2

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001024448.1 Gene:C37E2.2 / 183292 WormBaseID:WBGene00007994 Length:225 Species:Caenorhabditis elegans


Alignment Length:195 Identity:55/195 - (28%)
Similarity:96/195 - (49%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVNDFVGTNELTPKKPPAVR 97
            :::|.|      .:|.:. ||.:..|...||.|:.::...|.::.|:.          .|...::
 Worm    20 LWFDIN------RQPRLG-HHWYVYKLVMLTNLNFVLCVFYSVMILLG----------YKSEKLQ 67

  Fly    98 RFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHVLHTNIVVFIILELFIS 162
            :..|::..|..|||.:.....||.||||:..||.|..:..:.||||||:.||..::||||:.:..
 Worm    68 KISDFMHFTSIFPVGMITCGLFWGLYAINPALVMPDWIAKLIPSWLNHITHTYPIIFIILDSYFH 132

  Fly   163 YRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQLPQRILFFAAVVGFTLSLYLL 227
            .|:.||....|...|..:..|.:.|..|:.:.|.|:||:|.:......::.:  ::|| |..::|
 Worm   133 KRTPPKTIASLIFSAALVFVYFMIICYVRFFDGYWLYPILSLFAFEHFVISY--IIGF-LGFFML 194

  Fly   228  227
             Worm   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 55/195 (28%)
C37E2.2NP_001024448.1 Far-17a_AIG1 5..203 CDD:282588 55/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - LDO PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.