DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and cTel55X.1

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_510864.1 Gene:cTel55X.1 / 181791 WormBaseID:WBGene00007068 Length:233 Species:Caenorhabditis elegans


Alignment Length:217 Identity:56/217 - (25%)
Similarity:89/217 - (41%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LRTLLHLTAVVQFGYGIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVND 81
            ::.:.||.:.|.:....|.|...|    :...:.|.:....:|.:||.:|..:|.||:.:..:..
 Worm     2 IKVIFHLVSAVLYAAVCYRDTTIV----TGALLPIPYQTWSRFVWLTIIDLYMQLLYHTIGFILA 62

  Fly    82 FVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAID-----RELVFPKVLDPVFPS 141
            .|     :|.|...:  |..|..| |..|:.:.|.|.||.|:..|     |:.:..|:| .:|  
 Worm    63 VV-----SPNKRHII--FDYWARA-LTGPIGVAVTVLFWGLFLFDPATLARDEMAMKIL-TLF-- 116

  Fly   142 WLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVLQ 206
            |.||.|||...:...|:|.|...:....|..|.|:|:|:..||:                  ..|
 Worm   117 WFNHGLHTLPAITAHLDLAIYNHTSFSTSAILKGIAVFVTLYLI------------------DFQ 163

  Fly   207 LPQRILFFAAVVGFTLSLYLLG 228
            .|.|:|.|          :|||
 Worm   164 PPLRLLHF----------WLLG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 56/217 (26%)
cTel55X.1NP_510864.1 Far-17a_AIG1 2..>161 CDD:282588 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.