DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and Adtrp

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_780626.1 Gene:Adtrp / 109254 MGIID:1924596 Length:262 Species:Mus musculus


Alignment Length:234 Identity:81/234 - (34%)
Similarity:128/234 - (54%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TAVVQF---GYGIYYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVSLVND---- 81
            |.|..|   .:.|:.:|:..|...:|.::|..|. ||:.||||.|:.::||:::.|:.::|    
Mouse    38 TCVYHFLVLNWYIFLNYHIPQIGRNEEKLREFHD-GGRSKYLTLLNLLLQAIFFGVACLDDVLKR 101

  Fly    82 FVGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFPSWLNHV 146
            .:|..::     ..|..|:|.|..|:|||::..|.:.||||:..||.||:||.||..||:|:||.
Mouse   102 VIGRKDI-----KFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDDFFPAWVNHA 161

  Fly   147 LHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLV---WIHVVKHYSGVWVYPVLEVLQLP 208
            :||:|..|.:.|..:...:||.:..||..|..|..||::   |.:|   .:|.|||||.:.|...
Mouse   162 MHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYV---QTGNWVYPVFDSLSPL 223

  Fly   209 QRILFFAAVVGFTLSLYLLGEFLNNTVWAKEVKLAKRKS 247
            ..|:||:|.......:||.||.:|:..|....|...:|:
Mouse   224 GIIIFFSAAYILVAGIYLFGEKINHWKWGAIAKPQMKKN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 77/218 (35%)
AdtrpNP_780626.1 Far-17a_AIG1 37..248 CDD:282588 77/218 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5572
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.