DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3625 and LOC100537455

DIOPT Version :9

Sequence 1:NP_608514.1 Gene:CG3625 / 33198 FlyBaseID:FBgn0031245 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_021336569.1 Gene:LOC100537455 / 100537455 -ID:- Length:242 Species:Danio rerio


Alignment Length:229 Identity:75/229 - (32%)
Similarity:118/229 - (51%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GALRTLLHLTAVVQFGYGI--YYDYNYVQFPTSEPEMRIHHPWGGKFKYLTFLDAIIQALYYIVS 77
            |.::|..|:.|...:.:.|  .|..:....|:.      ...:||.:||||||:.::|.:::.::
Zfish    16 GVMKTFCHIAAFSWYAFIIQCIYAKDVSDLPSG------IFVYGGPWKYLTFLNLVLQMVFFGLA 74

  Fly    78 LVNDF--VGTNELTPKKPPAVRRFKDWLMATLAFPVAINVGVTFWTLYAIDRELVFPKVLDPVFP 140
            .|||.  ||..    .|...:...||.|.:...|||.:.|.:.||.::|.||:||:|..:|..||
Zfish    75 SVNDLQPVGKG----SKMSLLCLCKDLLFSVFVFPVGMFVVLLFWLIFAYDRQLVYPASIDNFFP 135

  Fly   141 SWLNHVLHTNIVVFIILELFISYRSYPKRSQGLAGLAIFMGAYLVWIHVVKHYSGVWVYPVLEVL 205
            .||||.:||.::..:..|:.:....:||...|||.|.:...|||.|:..|....|:||||:|.:.
Zfish   136 PWLNHAMHTVVLPILFGEILLEPHVFPKTKNGLAALGVVGLAYLGWVIWVYCTVGIWVYPLLGLF 200

  Fly   206 QLPQRILFFAAVVGFTLSLYLLGEFLNNTVWAKE 239
            ......:||...:.....|:|||:.||..||.|:
Zfish   201 SHSGLAIFFFLNMLVVSLLFLLGKALNYKVWGKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3625NP_608514.1 Far-17a_AIG1 17..233 CDD:282588 70/219 (32%)
LOC100537455XP_021336569.1 Far-17a_AIG1 23..227 CDD:309749 68/213 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102603
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.